Recombinant Full Length Human NKX3-1 Protein, GST-tagged

Cat.No. : NKX3-1-6706HF
Product Overview : Human NKX3-1 full-length ORF ( ABZ92171.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 234 amino acids
Description : The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM
Molecular Mass : 25.8 kDa
AA Sequence : MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKX3-1 NK3 homeobox 1 [ Homo sapiens ]
Official Symbol NKX3-1
Synonyms NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1; NK homeobox, family 3, A; homeobox protein NK-3 homolog A; NK3 transcription factor homolog A; NK3 transcription factor related, locus 1; NKX3; NKX3A;
Gene ID 4824
mRNA Refseq NM_001256339
Protein Refseq NP_001243268
MIM 602041
UniProt ID Q99801

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX3-1 Products

Required fields are marked with *

My Review for All NKX3-1 Products

Required fields are marked with *

0
cart-icon