Recombinant Full Length Human NKX6-3 Protein, GST-tagged

Cat.No. : NKX6-3-6708HF
Product Overview : Human NKX6-3 full-length ORF ( AAI56230.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 135 amino acids
Description : The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas (Alanentalo et al., 2006 [PubMed 16326147]).[supplied by OMIM
Molecular Mass : 41.25 kDa
AA Sequence : MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKX6-3 NK6 homeobox 3 [ Homo sapiens ]
Official Symbol NKX6-3
Synonyms NKX6-3; NK6 homeobox 3; NK6 transcription factor related, locus 3 (Drosophila); homeobox protein Nkx-6.3; FLJ25169; NK6 transcription factor related, locus 3; NKX6.3;
Gene ID 157848
mRNA Refseq NM_152568
Protein Refseq NP_689781
MIM 610772
UniProt ID A6NJ46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX6-3 Products

Required fields are marked with *

My Review for All NKX6-3 Products

Required fields are marked with *

0
cart-icon
0
compare icon