Recombinant Full Length Human NKX6-3 Protein, GST-tagged
Cat.No. : | NKX6-3-6708HF |
Product Overview : | Human NKX6-3 full-length ORF ( AAI56230.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 135 amino acids |
Description : | The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas (Alanentalo et al., 2006 [PubMed 16326147]).[supplied by OMIM |
Molecular Mass : | 41.25 kDa |
AA Sequence : | MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKX6-3 NK6 homeobox 3 [ Homo sapiens ] |
Official Symbol | NKX6-3 |
Synonyms | NKX6-3; NK6 homeobox 3; NK6 transcription factor related, locus 3 (Drosophila); homeobox protein Nkx-6.3; FLJ25169; NK6 transcription factor related, locus 3; NKX6.3; |
Gene ID | 157848 |
mRNA Refseq | NM_152568 |
Protein Refseq | NP_689781 |
MIM | 610772 |
UniProt ID | A6NJ46 |
◆ Recombinant Proteins | ||
Nkx6-3-4428M | Recombinant Mouse Nkx6-3 Protein, Myc/DDK-tagged | +Inquiry |
NKX6-1008H | Recombinant Human NKX6 Protein, MYC/DDK-tagged | +Inquiry |
NKX6-3-5907H | Recombinant Human NKX6-3 Protein, GST-tagged | +Inquiry |
NKX6-3-1116H | Recombinant Human NKX6-3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NKX6-3-6708HF | Recombinant Full Length Human NKX6-3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKX6-3810HCL | Recombinant Human NKX6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX6-3 Products
Required fields are marked with *
My Review for All NKX6-3 Products
Required fields are marked with *