Recombinant Human NKX6-3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NKX6-3-1116H
Product Overview : NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_689781) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The NKX family of homeodomain proteins controls numerous developmental processes. Members of the NKX6 subfamily, including NKX6-3, are involved in development of the central nervous system (CNS), gastrointestinal tract, and pancreas.
Molecular Mass : 14.1 kDa
AA Sequence : MQQGQLAPGSRLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NKX6-3 NK6 homeobox 3 [ Homo sapiens (human) ]
Official Symbol NKX6-3
Synonyms NKX6-3; NK6 homeobox 3; NK6 transcription factor related, locus 3 (Drosophila); homeobox protein Nkx-6.3; FLJ25169; NK6 transcription factor related, locus 3; NKX6.3;
Gene ID 157848
mRNA Refseq NM_152568
Protein Refseq NP_689781
MIM 610772
UniProt ID A6NJ46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX6-3 Products

Required fields are marked with *

My Review for All NKX6-3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon