Recombinant Full Length Human NME7 Protein, GST-tagged
Cat.No. : | NME7-7011HF |
Product Overview : | Recombinant Human full-length NME7(1 a.a. - 376 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 376 amino acids |
Description : | This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two kinase domains, one of which is involved in autophosphorylation and the other may be inactive. This protein localizes to the centrosome and functions as a component of the gamma-tubulin ring complex which plays a role in microtubule organization. Mutations in this gene may be associated with venous thromboembolism. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 68.9 kDa |
AA Sequence : | MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVL IDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELI QFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS GGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD N |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NME7 NME/NM23 family member 7 [ Homo sapiens (human) ] |
Official Symbol | NME7 |
Synonyms | NME7; NME/NM23 family member 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); EC 2.7.4.6; FLJ37194; MN23H7; NDK 7; nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; nm23-H7; OTTHUMP00000032536; OTTHUMP00000231077; OTTHUMP00000231078 |
Gene ID | 29922 |
mRNA Refseq | NM_013330 |
Protein Refseq | NP_037462 |
MIM | 613465 |
UniProt ID | Q9Y5B8 |
◆ Recombinant Proteins | ||
Nme7-4440M | Recombinant Mouse Nme7 Protein, Myc/DDK-tagged | +Inquiry |
NME7-48H | Recombinant Human NME7, MYC/DDK-tagged | +Inquiry |
NME7-49H | Recombinant Human NME7, GST-tagged | +Inquiry |
NME7-8570Z | Recombinant Zebrafish NME7 | +Inquiry |
NME7-301365H | Recombinant Human NME7 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME7-3786HCL | Recombinant Human NME7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME7 Products
Required fields are marked with *
My Review for All NME7 Products
Required fields are marked with *
0
Inquiry Basket