Recombinant Full Length Human NME7 Protein, GST-tagged

Cat.No. : NME7-7011HF
Product Overview : Recombinant Human full-length NME7(1 a.a. - 376 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 376 amino acids
Description : This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two kinase domains, one of which is involved in autophosphorylation and the other may be inactive. This protein localizes to the centrosome and functions as a component of the gamma-tubulin ring complex which plays a role in microtubule organization. Mutations in this gene may be associated with venous thromboembolism. Alternate splicing results in multiple transcript variants.
Molecular Mass : 68.9 kDa
AA Sequence : MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVL IDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELI QFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS GGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD N
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NME7 NME/NM23 family member 7 [ Homo sapiens (human) ]
Official Symbol NME7
Synonyms NME7; NME/NM23 family member 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); EC 2.7.4.6; FLJ37194; MN23H7; NDK 7; nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; nm23-H7; OTTHUMP00000032536; OTTHUMP00000231077; OTTHUMP00000231078
Gene ID 29922
mRNA Refseq NM_013330
Protein Refseq NP_037462
MIM 613465
UniProt ID Q9Y5B8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME7 Products

Required fields are marked with *

My Review for All NME7 Products

Required fields are marked with *

0
cart-icon