Recombinant Human NME7, GST-tagged

Cat.No. : NME7-49H
Product Overview : Recombinant Human NME7(277 a.a. - 374 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Molecular Mass : 36.52 kDa
AA Sequence : DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQ NAVHCTDLPEDGLLEVQYFFKIL
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) [Homo sapiens]
Official Symbol NME7
Synonyms NME7; NME/NM23 family member 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); EC 2.7.4.6; FLJ37194; MN23H7; NDK 7; nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; nm23-H7; OTTHUMP00000032536; OTTHUMP00000231077; OTTHUMP00000231078
Gene ID 29922
mRNA Refseq NM_013330
Protein Refseq NP_037462
MIM 613465
UniProt ID Q9Y5B8
Chromosome Location 1q24
Pathway Adenine ribonucleotide biosynthesis, IMP =>ADP,ATP; Purine metabolism; Pyrimidine ribonucleotide biosynthesis, UMP =>UDP/UTP,CDP/CTP
Function ATP binding; metal ion binding; nucleoside diphosphate kinase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME7 Products

Required fields are marked with *

My Review for All NME7 Products

Required fields are marked with *

0
cart-icon
0
compare icon