Recombinant Human NME7, GST-tagged
| Cat.No. : | NME7-49H |
| Product Overview : | Recombinant Human NME7(277 a.a. - 374 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQ NAVHCTDLPEDGLLEVQYFFKIL |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) [Homo sapiens] |
| Official Symbol | NME7 |
| Synonyms | NME7; NME/NM23 family member 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); EC 2.7.4.6; FLJ37194; MN23H7; NDK 7; nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; nm23-H7; OTTHUMP00000032536; OTTHUMP00000231077; OTTHUMP00000231078 |
| Gene ID | 29922 |
| mRNA Refseq | NM_013330 |
| Protein Refseq | NP_037462 |
| MIM | 613465 |
| UniProt ID | Q9Y5B8 |
| Chromosome Location | 1q24 |
| Pathway | Adenine ribonucleotide biosynthesis, IMP =>ADP,ATP; Purine metabolism; Pyrimidine ribonucleotide biosynthesis, UMP =>UDP/UTP,CDP/CTP |
| Function | ATP binding; metal ion binding; nucleoside diphosphate kinase activity |
| ◆ Recombinant Proteins | ||
| NME7-301365H | Recombinant Human NME7 protein, GST-tagged | +Inquiry |
| NME7-3664R | Recombinant Rat NME7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NME7-48H | Recombinant Human NME7, MYC/DDK-tagged | +Inquiry |
| Nme7-4440M | Recombinant Mouse Nme7 Protein, Myc/DDK-tagged | +Inquiry |
| NME7-2170H | Recombinant Human NME7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NME7-3786HCL | Recombinant Human NME7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME7 Products
Required fields are marked with *
My Review for All NME7 Products
Required fields are marked with *
