Recombinant Full Length Human NMNAT3 Protein, GST-tagged

Cat.No. : NMNAT3-6597HF
Product Overview : Human NMNAT3 full-length ORF ( NP_835471.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 215 amino acids
Description : The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM
Molecular Mass : 50.5 kDa
AA Sequence : MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NMNAT3 nicotinamide nucleotide adenylyltransferase 3 [ Homo sapiens ]
Official Symbol NMNAT3
Synonyms NMNAT3; nicotinamide nucleotide adenylyltransferase 3; nicotinamide mononucleotide adenylyltransferase 3; PNAT3; NMN adenylyltransferase 3; NaMN adenylyltransferase 3; pyridine nucleotide adenylyltransferase 3; nicotinate-nucleotide adenylyltransferase 3; FKSG76; PNAT-3;
Gene ID 349565
mRNA Refseq NM_001200047
Protein Refseq NP_001186976
MIM 608702
UniProt ID Q96T66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NMNAT3 Products

Required fields are marked with *

My Review for All NMNAT3 Products

Required fields are marked with *

0
cart-icon