Recombinant Human NMNAT3 Protein, GST-tagged
Cat.No. : | NMNAT3-5942H |
Product Overview : | Human NMNAT3 full-length ORF ( NP_835471.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NMNAT3 nicotinamide nucleotide adenylyltransferase 3 [ Homo sapiens ] |
Official Symbol | NMNAT3 |
Synonyms | NMNAT3; nicotinamide nucleotide adenylyltransferase 3; nicotinamide mononucleotide adenylyltransferase 3; PNAT3; NMN adenylyltransferase 3; NaMN adenylyltransferase 3; pyridine nucleotide adenylyltransferase 3; nicotinate-nucleotide adenylyltransferase 3; FKSG76; PNAT-3; |
Gene ID | 349565 |
mRNA Refseq | NM_001200047 |
Protein Refseq | NP_001186976 |
MIM | 608702 |
UniProt ID | Q96T66 |
◆ Recombinant Proteins | ||
NMNAT3-4679H | Recombinant Human NMNAT3 protein, His-SUMO-tagged | +Inquiry |
NMNAT3-6597HF | Recombinant Full Length Human NMNAT3 Protein, GST-tagged | +Inquiry |
NMNAT3-639H | Recombinant Human NMNAT3, His-tagged | +Inquiry |
NMNAT3-6115M | Recombinant Mouse NMNAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NMNAT3-10749M | Recombinant Mouse NMNAT3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMNAT3-1201HCL | Recombinant Human NMNAT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMNAT3 Products
Required fields are marked with *
My Review for All NMNAT3 Products
Required fields are marked with *
0
Inquiry Basket