Recombinant Human NOL3 protein, His-tagged

Cat.No. : NOL3-209H
Product Overview : Recombinant Human NOL3(1-208 aa) fused with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-208 aa
Form : Tris-based buffer, 50% glycerol
AA Sequence : MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQE LLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTP EEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Purity : >90% (SDS-PAGE)
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ]
Official Symbol NOL3
Synonyms NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304;
Gene ID 8996
mRNA Refseq NM_001185057
Protein Refseq NP_001171986
MIM 605235
UniProt ID O60936
Chromosome Location 16q22.1
Function RNA binding; identical protein binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOL3 Products

Required fields are marked with *

My Review for All NOL3 Products

Required fields are marked with *

0
cart-icon