Recombinant Human NOL3 protein, His-tagged
Cat.No. : | NOL3-209H |
Product Overview : | Recombinant Human NOL3(1-208 aa) fused with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-208 aa |
Form : | Tris-based buffer, 50% glycerol |
AA Sequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQE LLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTP EEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
Purity : | >90% (SDS-PAGE) |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Gene Name | NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ] |
Official Symbol | NOL3 |
Synonyms | NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304; |
Gene ID | 8996 |
mRNA Refseq | NM_001185057 |
Protein Refseq | NP_001171986 |
MIM | 605235 |
UniProt ID | O60936 |
Chromosome Location | 16q22.1 |
Function | RNA binding; identical protein binding; protein binding; |
◆ Recombinant Proteins | ||
NOL3-4018R | Recombinant Rat NOL3 Protein | +Inquiry |
NOL3-1325H | Recombinant Human NOL3, GST-tagged | +Inquiry |
NOL3-5270H | Recombinant Human NOL3 Protein (Met1-Ser208) | +Inquiry |
NOL3-3281H | Recombinant Human NOL3 protein, His-SUMO-tagged | +Inquiry |
Nol3-4453M | Recombinant Mouse Nol3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOL3 Products
Required fields are marked with *
My Review for All NOL3 Products
Required fields are marked with *
0
Inquiry Basket