"NOL3" Related Products

Expand

Recombinant Human NOL3 protein, His-tagged

Cat.No.: NOL3-209H
Product Overview: Recombinant Human NOL3(1-208 aa) fused with His tag was expressed in HEK293.
Source: HEK293
Species: Human
Tag: His
Form: Tris-based buffer, 50% glycerol
Protein length: 1-208 aa
AA Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQE LLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTP EEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Purity: >90% (SDS-PAGE)
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name: NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ]
Official Symbol: NOL3
Synonyms: NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304;
Gene ID: 8996
mRNA Refseq: NM_001185057
Protein Refseq: NP_001171986
MIM: 605235
UniProt ID: O60936
Chromosome Location: 16q22.1
Function: RNA binding; identical protein binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.