Recombinant Human NOL3 protein, His-tagged
| Cat.No. : | NOL3-209H |
| Product Overview : | Recombinant Human NOL3(1-208 aa) fused with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-208 aa |
| Form : | Tris-based buffer, 50% glycerol |
| AA Sequence : | MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQE LLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTP EEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
| Purity : | >90% (SDS-PAGE) |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Gene Name | NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ] |
| Official Symbol | NOL3 |
| Synonyms | NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304; |
| Gene ID | 8996 |
| mRNA Refseq | NM_001185057 |
| Protein Refseq | NP_001171986 |
| MIM | 605235 |
| UniProt ID | O60936 |
| Chromosome Location | 16q22.1 |
| Function | RNA binding; identical protein binding; protein binding; |
| ◆ Recombinant Proteins | ||
| NOL3-5270H | Recombinant Human NOL3 Protein (Met1-Ser208) | +Inquiry |
| NOL3-209H | Recombinant Human NOL3 protein, His-tagged | +Inquiry |
| NOL3-3281H | Recombinant Human NOL3 protein, His-SUMO-tagged | +Inquiry |
| NOL3-5269H | Recombinant Human NOL3 Protein (Met1-Ser208), N-Gst tagged | +Inquiry |
| NOL3-1325H | Recombinant Human NOL3 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL3 Products
Required fields are marked with *
My Review for All NOL3 Products
Required fields are marked with *
