Recombinant Human NOL3 protein, His-tagged

• Cat.No.: NOL3-209H
• Product Overview: Recombinant Human NOL3(1-208 aa) fused with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-208 aa
• Form: Tris-based buffer, 50% glycerol
• AA Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQE LLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTP EEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
• Purity: >90% (SDS-PAGE)
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: NOL3 nucleolar protein 3 (apoptosis repressor with CARD domain) [ Homo sapiens ]
• Official Symbol: NOL3
• Synonyms: NOL3; nucleolar protein 3 (apoptosis repressor with CARD domain); nucleolar protein 3; ARC; CARD2; MYP; NOP30; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein; NOP; FLJ35304
• Gene ID: 8996
• mRNA Refseq: NM_001185057
• Protein Refseq: NP_001171986
• MIM: 605235
• UniProt ID: O60936
• Chromosome Location: 16q22.1
• Function: RNA binding; identical protein binding; protein binding