Recombinant Full Length Human NOL7 Protein, GST-tagged
Cat.No. : | NOL7-6697HF |
Product Overview : | Human NOL7 full-length ORF ( NP_057251.2, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | The protein encoded by this gene localizes to the nucleolus, where it maintains nucleolar structure and cell growth rates. The encoded protein also functions as a tumor suppressor and regulator of angiogenesis. The RB tumor suppressor gene recruits transcription factors to this gene and positively regulates its expression. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 55.8 kDa |
AA Sequence : | MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOL7 nucleolar protein 7, 27kDa [ Homo sapiens (human) ] |
Official Symbol | NOL7 |
Synonyms | NOL7; PQBP3; RARG-1; C6orf90; dJ223E5.2; nucleolar protein 7, 27kDa; nucleolar protein 7; nucleolar protein of 27 kDa; polyglutamine binding protein 3; retinoic acid repressible protein |
Gene ID | 51406 |
mRNA Refseq | NM_016167 |
Protein Refseq | NP_057251 |
MIM | 611533 |
UniProt ID | Q9UMY1 |
◆ Recombinant Proteins | ||
NOL7-1328H | Recombinant Human NOL7, GST-tagged | +Inquiry |
NOL7-2884R | Recombinant Rhesus Macaque NOL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOL7-5976H | Recombinant Human NOL7 Protein, GST-tagged | +Inquiry |
NOL7-6697HF | Recombinant Full Length Human NOL7 Protein, GST-tagged | +Inquiry |
NOL7-3065R | Recombinant Rhesus monkey NOL7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOL7-1203HCL | Recombinant Human NOL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL7 Products
Required fields are marked with *
My Review for All NOL7 Products
Required fields are marked with *
0
Inquiry Basket