Recombinant Human NOL7 Protein, GST-tagged

Cat.No. : NOL7-5976H
Product Overview : Human NOL7 full-length ORF ( NP_057251.2, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene localizes to the nucleolus, where it maintains nucleolar structure and cell growth rates. The encoded protein also functions as a tumor suppressor and regulator of angiogenesis. The RB tumor suppressor gene recruits transcription factors to this gene and positively regulates its expression. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Dec 2015]
Molecular Mass : 55.8 kDa
AA Sequence : MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOL7 nucleolar protein 7, 27kDa [ Homo sapiens (human) ]
Official Symbol NOL7
Synonyms NOL7; PQBP3; RARG-1; C6orf90; dJ223E5.2; nucleolar protein 7, 27kDa; nucleolar protein 7; nucleolar protein of 27 kDa; polyglutamine binding protein 3; retinoic acid repressible protein
Gene ID 51406
mRNA Refseq NM_016167
Protein Refseq NP_057251
MIM 611533
UniProt ID Q9UMY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOL7 Products

Required fields are marked with *

My Review for All NOL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon