Recombinant Full Length Human NOVA1 Protein, C-Flag-tagged
Cat.No. : | NOVA1-974HFL |
Product Overview : | Recombinant Full Length Human NOVA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ TIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQT TVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQK PDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLP TAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAA SANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGS KDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQ RITYEQGVRAANPQKVGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NOVA1 NOVA alternative splicing regulator 1 [ Homo sapiens (human) ] |
Official Symbol | NOVA1 |
Synonyms | Nova-1 |
Gene ID | 4857 |
mRNA Refseq | NM_002515.3 |
Protein Refseq | NP_002506.2 |
MIM | 602157 |
UniProt ID | P51513 |
◆ Recombinant Proteins | ||
NOVA1-1527H | Recombinant Human NOVA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOVA1-2893R | Recombinant Rhesus Macaque NOVA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOVA1-6720HF | Recombinant Full Length Human NOVA1 Protein, GST-tagged | +Inquiry |
NOVA1-3929Z | Recombinant Zebrafish NOVA1 | +Inquiry |
NOVA1-4723H | Recombinant Human NOVA1 Protein (Ala295-Gly507), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOVA1-3752HCL | Recombinant Human NOVA1 293 Cell Lysate | +Inquiry |
NOVA1-3753HCL | Recombinant Human NOVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOVA1 Products
Required fields are marked with *
My Review for All NOVA1 Products
Required fields are marked with *
0
Inquiry Basket