Recombinant Full Length Human NPHP1 Protein, GST-tagged

Cat.No. : NPHP1-6620HF
Product Overview : Human NPHP1 full-length ORF ( NP_997064.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 121 amino acids
Description : This gene encodes a protein with src homology domain 3 (SH3) patterns. This protein interacts with Crk-associated substrate, and it appears to function in the control of cell division, as well as in cell-cell and cell-matrix adhesion signaling, likely as part of a multifunctional complex localized in actin- and microtubule-based structures. Mutations in this gene cause familial juvenile nephronophthisis type 1, a kidney disorder involving both tubules and glomeruli. Defects in this gene are also associated with Senior-Loken syndrome type 1, also referred to as juvenile nephronophthisis with Leber amaurosis, which is characterized by kidney and eye disease, and with Joubert syndrome type 4, which is characterized by cerebellar ataxia, oculomotor apraxia, psychomotor delay and neonatal breathing abnormalities, sometimes including retinal dystrophy and renal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 40.7 kDa
AA Sequence : MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEYASFLPFFFLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPHP1 nephronophthisis 1 (juvenile) [ Homo sapiens ]
Official Symbol NPHP1
Synonyms NPHP1; nephronophthisis 1 (juvenile); NPH1; nephrocystin-1; JBTS4; nephrocystin 1; juvenile nephronophthisis 1 protein; SLSN1; FLJ97602;
Gene ID 4867
mRNA Refseq NM_000272
Protein Refseq NP_000263
MIM 607100
UniProt ID O15259

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHP1 Products

Required fields are marked with *

My Review for All NPHP1 Products

Required fields are marked with *

0
cart-icon