Recombinant Full Length Human NPPA Protein, GST-tagged

Cat.No. : NPPA-6641HF
Product Overview : Human NPPA full-length ORF ( AAH05893, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 153 amino acids
Description : The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. [provided by RefSeq
Molecular Mass : 42.57 kDa
AA Sequence : MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPPA natriuretic peptide A [ Homo sapiens ]
Official Symbol NPPA
Synonyms NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A; atriopeptin; cardionatrin; prepronatriodilatin; natriuretic peptide precursor A; ANF; ANP; PND; ATFB6; CDD-ANF;
Gene ID 4878
mRNA Refseq NM_006172
Protein Refseq NP_006163
MIM 108780
UniProt ID P01160

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPPA Products

Required fields are marked with *

My Review for All NPPA Products

Required fields are marked with *

0
cart-icon