Recombinant Full Length Human NR2F2 Protein, GST-tagged
Cat.No. : | NR2F2-3323HF |
Product Overview : | Human NR2F2 full-length ORF ( NP_066285.1, 1 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 414 amino acids |
Description : | This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 72 kDa |
AA Sequence : | MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NR2F2 nuclear receptor subfamily 2 group F member 2 [ Homo sapiens (human) ] |
Official Symbol | NR2F2 |
Synonyms | ARP1,COUP-TFII,COUPTFB,MGC117452,SVP40,TFCOUP2 |
Gene ID | 7026 |
mRNA Refseq | NM_021005.2 |
Protein Refseq | NP_066285.1 |
MIM | 107773 |
UniProt ID | P24468 |
◆ Recombinant Proteins | ||
NR2F2-4067R | Recombinant Rat NR2F2 Protein | +Inquiry |
NR2F2-3323HF | Recombinant Full Length Human NR2F2 Protein, GST-tagged | +Inquiry |
NR2F2-6187M | Recombinant Mouse NR2F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR2F2-10867M | Recombinant Mouse NR2F2 Protein | +Inquiry |
NR2F2-5991C | Recombinant Chicken NR2F2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2F2-1217HCL | Recombinant Human NR2F2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR2F2 Products
Required fields are marked with *
My Review for All NR2F2 Products
Required fields are marked with *