Recombinant Full Length Human NR2F2 Protein, GST-tagged
Cat.No. : | NR2F2-3323HF |
Product Overview : | Human NR2F2 full-length ORF ( NP_066285.1, 1 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 414 amino acids |
Description : | This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 72 kDa |
AA Sequence : | MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NR2F2 nuclear receptor subfamily 2 group F member 2 [ Homo sapiens (human) ] |
Official Symbol | NR2F2 |
Synonyms | ARP1,COUP-TFII,COUPTFB,MGC117452,SVP40,TFCOUP2 |
Gene ID | 7026 |
mRNA Refseq | NM_021005.2 |
Protein Refseq | NP_066285.1 |
MIM | 107773 |
UniProt ID | P24468 |
◆ Recombinant Proteins | ||
CMTM5-3636M | Recombinant Mouse CMTM5 Protein | +Inquiry |
TUBA1B-38H | Recombinant Human TUBA1B protein, His-tagged | +Inquiry |
VILL-724H | Recombinant Human VILL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL30378HF | Recombinant Full Length Human Mitochondrial Inner Membrane Organizing System Protein 1(Minos1) Protein, His-Tagged | +Inquiry |
SPRYD7-519H | Recombinant Human SPRYD7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
CA2-35R | Native Rhesus monkey Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG1B-953CCL | Recombinant Cynomolgus REG1B cell lysate | +Inquiry |
NADSYN1-3985HCL | Recombinant Human NADSYN1 293 Cell Lysate | +Inquiry |
Stomach-547E | Equine Stomach Lysate, Total Protein | +Inquiry |
ASNSD1-8648HCL | Recombinant Human ASNSD1 293 Cell Lysate | +Inquiry |
Lung-322R | Rhesus monkey Lung Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR2F2 Products
Required fields are marked with *
My Review for All NR2F2 Products
Required fields are marked with *
0
Inquiry Basket