Recombinant Full Length Human NR2F2 Protein, GST-tagged

Cat.No. : NR2F2-3323HF
Product Overview : Human NR2F2 full-length ORF ( NP_066285.1, 1 a.a. - 414 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 414 amino acids
Description : This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 72 kDa
AA Sequence : MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NR2F2 nuclear receptor subfamily 2 group F member 2 [ Homo sapiens (human) ]
Official Symbol NR2F2
Synonyms ARP1,COUP-TFII,COUPTFB,MGC117452,SVP40,TFCOUP2
Gene ID 7026
mRNA Refseq NM_021005.2
Protein Refseq NP_066285.1
MIM 107773
UniProt ID P24468

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR2F2 Products

Required fields are marked with *

My Review for All NR2F2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon