Recombinant Full Length Human NR4A2 Protein, C-Flag-tagged
Cat.No. : | NR4A2-371HFL |
Product Overview : | Recombinant Full Length Human NR4A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTG YDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHS PMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSH HVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTC EGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPK SPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFS SNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLP ELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPFSGPTRTRPLEQKLISEEDLAANDILDYKDDDD KVSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Full Length : | Full L. |
Gene Name | NR4A2 nuclear receptor subfamily 4 group A member 2 [ Homo sapiens (human) ] |
Official Symbol | NR4A2 |
Synonyms | NOT; RNR1; HZF-3; IDLDP; NURR1; TINUR |
Gene ID | 4929 |
mRNA Refseq | NM_006186.4 |
Protein Refseq | NP_006177.1 |
MIM | 601828 |
UniProt ID | P43354 |
◆ Recombinant Proteins | ||
NR4A2-371HFL | Recombinant Full Length Human NR4A2 Protein, C-Flag-tagged | +Inquiry |
NR4A2-2025H | Recombinant Human NR4A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NR4A2-3097R | Recombinant Rhesus monkey NR4A2 Protein, His-tagged | +Inquiry |
NR4A2-1020H | Recombinant Human NR4A2 Protein, GST-tagged | +Inquiry |
NR4A2-3730R | Recombinant Rat NR4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A2-3708HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
NR4A2-3707HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR4A2 Products
Required fields are marked with *
My Review for All NR4A2 Products
Required fields are marked with *
0
Inquiry Basket