Recombinant Full Length Human NRGN Protein, GST-tagged
Cat.No. : | NRGN-6831HF |
Product Overview : | Human NRGN full-length ORF ( AAH02835, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 78 amino acids |
Description : | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. |
Molecular Mass : | 34.32 kDa |
AA Sequence : | MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NRGN neurogranin [ Homo sapiens (human) ] |
Official Symbol | NRGN |
Synonyms | NRGN; neurogranin; RC3; hng |
Gene ID | 4900 |
mRNA Refseq | NM_006176 |
Protein Refseq | NP_006167 |
MIM | 602350 |
UniProt ID | Q92686 |
◆ Recombinant Proteins | ||
NRGN-241H | Recombinant Human NRGN protein, His-tagged | +Inquiry |
Nrgn-4500M | Recombinant Mouse Nrgn Protein, Myc/DDK-tagged | +Inquiry |
NRGN-1547H | Recombinant Human NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-5632C | Recombinant Chicken NRGN | +Inquiry |
NRGN-2920R | Recombinant Rhesus Macaque NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRGN-3696HCL | Recombinant Human NRGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRGN Products
Required fields are marked with *
My Review for All NRGN Products
Required fields are marked with *