Recombinant Full Length Human NRGN Protein, GST-tagged

Cat.No. : NRGN-6831HF
Product Overview : Human NRGN full-length ORF ( AAH02835, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 78 amino acids
Description : Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
Molecular Mass : 34.32 kDa
AA Sequence : MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NRGN neurogranin [ Homo sapiens (human) ]
Official Symbol NRGN
Synonyms NRGN; neurogranin; RC3; hng
Gene ID 4900
mRNA Refseq NM_006176
Protein Refseq NP_006167
MIM 602350
UniProt ID Q92686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRGN Products

Required fields are marked with *

My Review for All NRGN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon