Recombinant Full Length Human NTRK1 Protein, C-Flag-tagged
Cat.No. : | NTRK1-1505HFL |
Product Overview : | Recombinant Full Length Human NTRK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 86.7 kDa |
AA Sequence : | MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNLTCWAENDVGRAEVSVQV NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVGLAV FACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTT ESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKD VHARLQALAQAPPVYLDVLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | Apoptosis, Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Thyroid cancer |
Full Length : | Full L. |
Gene Name | NTRK1 neurotrophic receptor tyrosine kinase 1 [ Homo sapiens (human) ] |
Official Symbol | NTRK1 |
Synonyms | MTC; TRK; TRK1; TRKA; Trk-A; p140-TrkA |
Gene ID | 4914 |
mRNA Refseq | NM_001012331.2 |
Protein Refseq | NP_001012331.1 |
MIM | 191315 |
UniProt ID | P04629 |
◆ Recombinant Proteins | ||
NTRK1-1505HFL | Recombinant Full Length Human NTRK1 Protein, C-Flag-tagged | +Inquiry |
NTRK1-495H | Recombinant Human NTRK1, Fc-tagged | +Inquiry |
NTRK1-509RF | Recombinant Rabbit NTRK1 Protein, His-tagged, FITC conjugated | +Inquiry |
NTRK1-973HAF647 | Recombinant Human NTRK1 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
NTRK1-155HAF555 | Recombinant Human NTRK1 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTRK1-1068RCL | Recombinant Rat NTRK1 cell lysate | +Inquiry |
NTRK1-963CCL | Recombinant Canine NTRK1 cell lysate | +Inquiry |
NTRK1-2147HCL | Recombinant Human NTRK1 cell lysate | +Inquiry |
NTRK1-1086MCL | Recombinant Mouse NTRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTRK1 Products
Required fields are marked with *
My Review for All NTRK1 Products
Required fields are marked with *
0
Inquiry Basket