Recombinant Full Length Human NTRK2 Protein, C-Flag-tagged
Cat.No. : | NTRK2-1150HFL |
Product Overview : | Recombinant Full Length Human NTRK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 90.1 kDa |
AA Sequence : | MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQGVGPASVISND DDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKREL GEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLI MVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLV GENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPW YQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | MAPK signaling pathway, Neurotrophin signaling pathway |
Full Length : | Full L. |
Gene Name | NTRK2 neurotrophic receptor tyrosine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | NTRK2 |
Synonyms | OBHD; TRKB; DEE58; trk-B; EIEE58; GP145-TrkB |
Gene ID | 4915 |
mRNA Refseq | NM_006180.6 |
Protein Refseq | NP_006171.2 |
MIM | 600456 |
UniProt ID | Q16620 |
◆ Recombinant Proteins | ||
NTRK2-1150HFL | Recombinant Full Length Human NTRK2 Protein, C-Flag-tagged | +Inquiry |
NTRK2-157HF | Recombinant Human NTRK2 Protein, His-tagged, FITC conjugated | +Inquiry |
Ntrk2-1353MAF488 | Recombinant Mouse Ntrk2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
NTRK2-1041C | Recombinant Canine NTRK2 Protein, Fc-tagged | +Inquiry |
NTRK2-4103R | Recombinant Rat NTRK2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTRK2-1024CCL | Recombinant Canine NTRK2 cell lysate | +Inquiry |
NTRK2-1300RCL | Recombinant Rat NTRK2 cell lysate | +Inquiry |
NTRK2-2683HCL | Recombinant Human NTRK2 cell lysate | +Inquiry |
NTRK2-1843MCL | Recombinant Mouse NTRK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTRK2 Products
Required fields are marked with *
My Review for All NTRK2 Products
Required fields are marked with *
0
Inquiry Basket