Recombinant Full Length Human NUBP1 Protein
Cat.No. : | NUBP1-350HF |
Product Overview : | Recombinant full length Human NUBP1 with N terminal proprietary tag; Predicted MWt 61.27 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 320 amino acids |
Description : | NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al. |
Form : | Liquid |
Molecular Mass : | 61.270kDa inclusive of tags |
AA Sequence : | MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPD TAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLA EDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPV YVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDV DWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITT PQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKK ESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG QSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | NUBP1 nucleotide binding protein 1 [ Homo sapiens ] |
Official Symbol | NUBP1 |
Synonyms | NUBP1; nucleotide binding protein 1; NBP1, nucleotide binding protein 1 (E.coli MinD like) , nucleotide binding protein 1 (MinD homolog, E. coli); cytosolic Fe-S cluster assembly factor NUBP1 |
Gene ID | 4682 |
mRNA Refseq | NM_002484 |
Protein Refseq | NP_002475 |
MIM | 600280 |
UniProt ID | P53384 |
◆ Recombinant Proteins | ||
NUBP1-10952M | Recombinant Mouse NUBP1 Protein | +Inquiry |
NUBP1-28429TH | Recombinant Human NUBP1 | +Inquiry |
NUBP1-350HF | Recombinant Full Length Human NUBP1 Protein | +Inquiry |
NUBP1-28427TH | Recombinant Human NUBP1 | +Inquiry |
NUBP1-3768R | Recombinant Rat NUBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUBP1-3662HCL | Recombinant Human NUBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUBP1 Products
Required fields are marked with *
My Review for All NUBP1 Products
Required fields are marked with *