Recombinant Human NUBP1
| Cat.No. : | NUBP1-28429TH |
| Product Overview : | Recombinant fragment of Human NUBP1 with an N terminal proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PIIGVVENMSPFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
| Sequence Similarities : | Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily. |
| Gene Name | NUBP1 nucleotide binding protein 1 [ Homo sapiens ] |
| Official Symbol | NUBP1 |
| Synonyms | NUBP1; nucleotide binding protein 1; NBP1, nucleotide binding protein 1 (E.coli MinD like) , nucleotide binding protein 1 (MinD homolog, E. coli); cytosolic Fe-S cluster assembly factor NUBP1; |
| Gene ID | 4682 |
| mRNA Refseq | NM_002484 |
| Protein Refseq | NP_002475 |
| MIM | 600280 |
| Uniprot ID | P53384 |
| Chromosome Location | 16p13.13 |
| Function | 4 iron, 4 sulfur cluster binding; ATP binding; iron-sulfur cluster binding; metal ion binding; nucleoside-triphosphatase activity; |
| ◆ Recombinant Proteins | ||
| NUBP1-2322Z | Recombinant Zebrafish NUBP1 | +Inquiry |
| NUBP1-3768R | Recombinant Rat NUBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUBP1-350HF | Recombinant Full Length Human NUBP1 Protein | +Inquiry |
| NUBP1-4192C | Recombinant Chicken NUBP1 | +Inquiry |
| NUBP1-6241M | Recombinant Mouse NUBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUBP1-3662HCL | Recombinant Human NUBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUBP1 Products
Required fields are marked with *
My Review for All NUBP1 Products
Required fields are marked with *
