Recombinant Full Length Human NUDT22 Protein, C-Flag-tagged
Cat.No. : | NUDT22-2103HFL |
Product Overview : | Recombinant Full Length Human NUDT22 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables UDP-sugar diphosphatase activity and metal ion binding activity. Located in nucleoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAP IGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRS RQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIA RNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAII LYNRVQGSPTGAALGSPALLPPL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NUDT22 nudix hydrolase 22 [ Homo sapiens (human) ] |
Official Symbol | NUDT22 |
Synonyms | MGC13045 |
Gene ID | 84304 |
mRNA Refseq | NM_032344.4 |
Protein Refseq | NP_115720.2 |
UniProt ID | Q9BRQ3 |
◆ Recombinant Proteins | ||
NUDT22-2103HFL | Recombinant Full Length Human NUDT22 Protein, C-Flag-tagged | +Inquiry |
NUDT22-4117R | Recombinant Rat NUDT22 Protein | +Inquiry |
NUDT22-1578Z | Recombinant Zebrafish NUDT22 | +Inquiry |
NUDT22-6257M | Recombinant Mouse NUDT22 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT22-10973M | Recombinant Mouse NUDT22 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT22-3645HCL | Recombinant Human NUDT22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT22 Products
Required fields are marked with *
My Review for All NUDT22 Products
Required fields are marked with *
0
Inquiry Basket