Recombinant Full Length Human OGN Protein, C-Flag-tagged
Cat.No. : | OGN-741HFL |
Product Overview : | Recombinant Full Length Human OGN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.8 kDa |
AA Sequence : | MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG KHPNSFICLKRLPIGSYFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | OGN osteoglycin [ Homo sapiens (human) ] |
Official Symbol | OGN |
Synonyms | OG; OIF; SLRR3A |
Gene ID | 4969 |
mRNA Refseq | NM_033014.4 |
Protein Refseq | NP_148935.1 |
MIM | 602383 |
UniProt ID | P20774 |
◆ Recombinant Proteins | ||
OGN-1575H | Recombinant Human OGN Protein, His (Fc)-Avi-tagged | +Inquiry |
OGN-2978R | Recombinant Rhesus Macaque OGN Protein, His (Fc)-Avi-tagged | +Inquiry |
OGN-1673H | Recombinant Human OGN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ogn-7998R | Recombinant Rat Ogn protein, His-tagged | +Inquiry |
OGN-914H | Recombinant Human OGN, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OGN-3591HCL | Recombinant Human OGN 293 Cell Lysate | +Inquiry |
OGN-3590HCL | Recombinant Human OGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OGN Products
Required fields are marked with *
My Review for All OGN Products
Required fields are marked with *
0
Inquiry Basket