Recombinant Full Length Human OTOGL Protein, GST-tagged

Cat.No. : OTOGL-1762HF
Product Overview : Human C12orf64 full-length ORF ( AAI01017.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 224 amino acids
Description : The protein encoded by this gene belongs to the otogelin family. This gene is expressed in the inner ear of vertebrates with the highest level of expression seen at the embryonic stage and lowest in adult. Knockdown studies in zebrafish suggest that this gene is essential for normal inner ear function. Mutations in this gene are associated with autosomal recessive deafness.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 51.8 kDa
AA Sequence : MIKYLEEDFCYAIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDYGCCGTCKNVSCKFHMENGTSVVYAVGSTWHYNCTTYECVKTDEGAIILNYTMVCPPFNETECKMNEGIVKLYNEGCCKICKREERICQKVIIKSVIRKQDCMSQSPINVASCDGKCPSATIYNINIESHLRFCKCCRENGVRNLSVPLYCSGNGTEIMYTLQEPIDCTCQWN
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name OTOGL otogelin like [ Homo sapiens (human) ]
Official Symbol OTOGL
Synonyms DFNB84B; C12orf64
Gene ID 283310
mRNA Refseq NM_173591.3
Protein Refseq NP_775862.3
MIM 614925
UniProt ID Q3ZCN5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OTOGL Products

Required fields are marked with *

My Review for All OTOGL Products

Required fields are marked with *

0
cart-icon
0
compare icon