Recombinant Full Length Human PAQR8 Protein, GST-tagged

Cat.No. : PAQR8-3430HF
Product Overview : Human PAQR8 full-length ORF (AAH30664, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 354 amino acids
Description : PAQR8 (Progestin And AdipoQ Receptor Family Member 8) is a Protein Coding gene. Diseases associated with PAQR8 include Epilepsy With Generalized Tonic-Clonic Seizures and Adolescence-Adult Electroclinical Syndrome. GO annotations related to this gene include steroid hormone receptor activity and steroid binding. An important paralog of this gene is PAQR7.
Molecular Mass : 64.68 kDa
AA Sequence : MTTAILERLSTLSVSGQRLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYCYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PAQR8 progestin and adipoQ receptor family member VIII [ Homo sapiens ]
Official Symbol PAQR8
Synonyms PAQR8; progestin and adipoQ receptor family member VIII; C6orf33, chromosome 6 open reading frame 33; membrane progestin receptor beta; LMPB1; MPRB; mPR beta; lysosomal membrane protein in brain 1; lysosomal membrane protein in brain-1; progestin and adipoQ receptor family member 8; C6orf33; FLJ32521; FLJ46206;
Gene ID 85315
mRNA Refseq NM_133367
Protein Refseq NP_588608
MIM 607780
UniProt ID Q8TEZ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAQR8 Products

Required fields are marked with *

My Review for All PAQR8 Products

Required fields are marked with *

0
cart-icon