Recombinant Full Length Human PBX homeobox 1 Protein, His&T7 tagged
Cat.No. : | PBX1-13HFL |
Product Overview : | Full-length human PBX1 cDNA (429 aa. Isoform-1) was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29 aa) fusion at its N-terminal in E. coli as inclusion bodies. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 1-430 aa |
Description : | This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Tag : | His&T7 |
Form : | Sterile-filtered liquid |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN |
Purity : | > 90% by SDS-PAGE |
Applications : | 1. May be used for study PBX1 mediated gene transcription regulation for endothelial to HSC differentiation in vitro by intracellular delivery of recombinant PBX1 protein using protein-delivery reagent. 2. May be used for mapping PBX1 protein-protein interaction. 3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. High purified native PBX1 protein, which may be used for specific antibody production. 5. Potential biomarker protein for cancer prognosis, such as gastric & breast cancer, et al. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least two weeks. |
Storage Buffer : | 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, DTT, Sucrose and others. |
Concentration : | 0.3 mg/mL |
Gene Name | PBX1 PBX homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | PBX1 |
Synonyms | PBX1; PBX homeobox 1; CAKUHED; pre-B-cell leukemia transcription factor 1; homeobox protein PBX1; homeobox protein PRL; pre-B-cell leukemia homeobox 1 |
Gene ID | 5087 |
mRNA Refseq | NM_002585 |
Protein Refseq | NP_002576 |
MIM | 176310 |
UniProt ID | P40424 |
◆ Recombinant Proteins | ||
PBX1-2499H | Recombinant Human PBX1 protein, GST-tagged | +Inquiry |
PBX1-14HFL | Recombinant Full Length Human PBX homeobox 1 Protein, Flag tagged | +Inquiry |
PBX1-6311C | Recombinant Chicken PBX1 | +Inquiry |
PBX1-6526M | Recombinant Mouse PBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PBX1-2878H | Recombinant Human PBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBX1-3408HCL | Recombinant Human PBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PBX1 Products
Required fields are marked with *
My Review for All PBX1 Products
Required fields are marked with *
0
Inquiry Basket