Recombinant Human PBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PBX1-2878H |
Product Overview : | PBX1 MS Standard C13 and N15-labeled recombinant protein (NP_002576) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PBX1 pre-B-cell leukemia homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | PBX1 |
Synonyms | PBX1; pre-B-cell leukemia homeobox 1; pre B cell leukemia transcription factor 1; pre-B-cell leukemia transcription factor 1; homeobox protein PRL; homeobox protein PBX1; MGC126627; DKFZp686B09108; |
Gene ID | 5087 |
mRNA Refseq | NM_002585 |
Protein Refseq | NP_002576 |
MIM | 176310 |
UniProt ID | P40424 |
◆ Recombinant Proteins | ||
PBX1-13HFL | Recombinant Full Length Human PBX homeobox 1 Protein, His&T7 tagged | +Inquiry |
PBX1-2499H | Recombinant Human PBX1 protein, GST-tagged | +Inquiry |
PBX1-12406M | Recombinant Mouse PBX1 Protein | +Inquiry |
PBX1-14HFL | Recombinant Full Length Human PBX homeobox 1 Protein, Flag tagged | +Inquiry |
PBX1-6526M | Recombinant Mouse PBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBX1-3408HCL | Recombinant Human PBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PBX1 Products
Required fields are marked with *
My Review for All PBX1 Products
Required fields are marked with *
0
Inquiry Basket