Recombinant Full Length Human PCOLCE Protein
Cat.No. : | PCOLCE-363HF |
Product Overview : | Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 449 amino acids |
Description : | Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. |
Form : | Liquid |
Molecular Mass : | 75.000kDa inclusive of tags |
AA Sequence : | MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ] |
Official Symbol | PCOLCE |
Synonyms | PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer |
Gene ID | 5118 |
mRNA Refseq | NM_002593 |
Protein Refseq | NP_002584 |
MIM | 600270 |
UniProt ID | Q15113 |
◆ Recombinant Proteins | ||
PCOLCE-4304R | Recombinant Rat PCOLCE Protein | +Inquiry |
PCOLCE-372H | Recombinant Human PCOLCE | +Inquiry |
PCOLCE-6802H | Recombinant Human PCOLCE protein, His & S-tagged | +Inquiry |
PCOLCE-30795TH | Recombinant Human PCOLCE | +Inquiry |
PCOLCE-6411H | Recombinant Human PCOLCE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCOLCE-3375HCL | Recombinant Human PCOLCE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCOLCE Products
Required fields are marked with *
My Review for All PCOLCE Products
Required fields are marked with *
0
Inquiry Basket