Recombinant Full Length Human PCOLCE Protein

• Cat.No.: PCOLCE-363HF
• Product Overview: Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113.

Specification

• Description: Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 75.000kDa inclusive of tags
• Protein Length: 449 amino acids
• AA Sequence: MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ]
• Official Symbol: PCOLCE
• Synonyms: PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer
• Gene ID: 5118
• mRNA Refseq: NM_002593
• Protein Refseq: NP_002584
• MIM: 600270
• UniProt ID: Q15113