Recombinant Full Length Human PCOLCE Protein
| Cat.No. : | PCOLCE-363HF |
| Product Overview : | Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 449 amino acids |
| Description : | Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. |
| Form : | Liquid |
| Molecular Mass : | 75.000kDa inclusive of tags |
| AA Sequence : | MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ] |
| Official Symbol | PCOLCE |
| Synonyms | PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer |
| Gene ID | 5118 |
| mRNA Refseq | NM_002593 |
| Protein Refseq | NP_002584 |
| MIM | 600270 |
| UniProt ID | Q15113 |
| ◆ Recombinant Proteins | ||
| PCOLCE-838H | Recombinant Human PCOLCE, T7-tagged | +Inquiry |
| PCOLCE-363HF | Recombinant Full Length Human PCOLCE Protein | +Inquiry |
| PCOLCE-6411H | Recombinant Human PCOLCE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PCOLCE-4304R | Recombinant Rat PCOLCE Protein | +Inquiry |
| PCOLCE-4819H | Recombinant Human PCOLCE Protein (Ala315-Cys437), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCOLCE-3375HCL | Recombinant Human PCOLCE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCOLCE Products
Required fields are marked with *
My Review for All PCOLCE Products
Required fields are marked with *
