Recombinant Full Length Human PCOLCE Protein

Cat.No. : PCOLCE-363HF
Product Overview : Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 449 amino acids
Description : Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
Form : Liquid
Molecular Mass : 75.000kDa inclusive of tags
AA Sequence : MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ]
Official Symbol PCOLCE
Synonyms PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer
Gene ID 5118
mRNA Refseq NM_002593
Protein Refseq NP_002584
MIM 600270
UniProt ID Q15113

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCOLCE Products

Required fields are marked with *

My Review for All PCOLCE Products

Required fields are marked with *

0
cart-icon