Recombinant Full Length Human PDLIM5 Protein, C-Flag-tagged
Cat.No. : | PDLIM5-1606HFL |
Product Overview : | Recombinant Full Length Human PDLIM5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a family of proteins that possess a 100-amino acid PDZ domain at the N terminus and one to three LIM domains at the C-terminus. This family member functions as a scaffold protein that tethers protein kinases to the Z-disk in striated muscles. It is thought to function in cardiomyocyte expansion and in restraining postsynaptic growth of excitatory synapses. Alternative splicing of this gene results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKI KGCTGSLNMTLQRASAAPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTSTNNMAYNKAPRPFGSVSSPKV TSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLHANANLSADQSPSALSAGKTAVNVPRQPTVT SVCSETSQELAEGQRRGSQGDSKQQNGPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQS RSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTTAAAFK PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMC AHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEV INALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWH DTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PDLIM5 PDZ and LIM domain 5 [ Homo sapiens (human) ] |
Official Symbol | PDLIM5 |
Synonyms | L9; ENH; LIM; ENH1 |
Gene ID | 10611 |
mRNA Refseq | NM_006457.5 |
Protein Refseq | NP_006448.5 |
MIM | 605904 |
UniProt ID | Q96HC4 |
◆ Recombinant Proteins | ||
PDLIM5-4014R | Recombinant Rat PDLIM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDLIM5-1624H | Recombinant Human PDLIM5 protein, GST-tagged | +Inquiry |
PDLIM5-2821C | Recombinant Chicken PDLIM5 | +Inquiry |
PDLIM5-3458H | Recombinant Human PDLIM5 protein, His-tagged | +Inquiry |
PDLIM5-4644H | Recombinant Human PDLIM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDLIM5-3325HCL | Recombinant Human PDLIM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDLIM5 Products
Required fields are marked with *
My Review for All PDLIM5 Products
Required fields are marked with *
0
Inquiry Basket