Recombinant Full Length Human Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor(Adcyap1R1) Protein, His-Tagged
| Cat.No. : | RFL-34483HF |
| Product Overview : | Recombinant Full Length Human Pituitary adenylate cyclase-activating polypeptide type I receptor(ADCYAP1R1) Protein (P41586) (21-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (21-468) |
| Form : | Lyophilized powder |
| AA Sequence : | MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPEL FRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRE RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGV NGGTQLSILSKSSSQIRMSGLPADNLAT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ADCYAP1R1 |
| Synonyms | ADCYAP1R1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1 |
| UniProt ID | P41586 |
| ◆ Recombinant Proteins | ||
| RFL-34483HF | Recombinant Full Length Human Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor(Adcyap1R1) Protein, His-Tagged | +Inquiry |
| RFL-15503MF | Recombinant Full Length Mouse Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor(Adcyap1R1) Protein, His-Tagged | +Inquiry |
| ADCYAP1R1-510H | Recombinant Human ADCYAP1R1 Protein, Fc-tagged | +Inquiry |
| ADCYAP1R1-3708C | Recombinant Chicken ADCYAP1R1 | +Inquiry |
| ADCYAP1R1-28657TH | Recombinant Human ADCYAP1R1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADCYAP1R1-1642HCL | Recombinant Human ADCYAP1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCYAP1R1 Products
Required fields are marked with *
My Review for All ADCYAP1R1 Products
Required fields are marked with *
