Recombinant Full Length Rat Pituitary Adenylate Cyclase-Activating Polypeptide Type Ia Receptor(Adcyap1R1) Protein, His-Tagged
Cat.No. : | RFL-6534RF |
Product Overview : | Recombinant Full Length Rat Pituitary adenylate cyclase-activating polypeptide type IA receptor(Adcyap1r1) Protein (P32215) (20-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-523) |
Form : | Lyophilized powder |
AA Sequence : | MHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQVGEMVLVSCPEV FRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE PESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIIILVQKLQSPDMGGNESSIYLTNLRLRVPKKTREDPLPVPSDQHSPPFLSCV QKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVF ELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGT QLSILSKSSSQLRMSSLPADNLAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Adcyap1r1 |
Synonyms | Adcyap1r1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1 |
UniProt ID | P32215 |
◆ Recombinant Proteins | ||
ADCYAP1R1-521R | Recombinant Rat ADCYAP1R1 Protein | +Inquiry |
ADCYAP1R1-177R | Recombinant Rat ADCYAP1R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCYAP1R1-335H | Recombinant Human ADCYAP1R1 Protein, GST-tagged | +Inquiry |
RFL12979BF | Recombinant Full Length Bovine Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor(Adcyap1R1) Protein, His-Tagged | +Inquiry |
ADCYAP1R1-3708C | Recombinant Chicken ADCYAP1R1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADCYAP1R1-1642HCL | Recombinant Human ADCYAP1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adcyap1r1 Products
Required fields are marked with *
My Review for All Adcyap1r1 Products
Required fields are marked with *
0
Inquiry Basket