Recombinant Full Length Human PKMYT1 Protein, C-Flag-tagged
Cat.No. : | PKMYT1-918HFL |
Product Overview : | Recombinant Full Length Human PKMYT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. The activity of the encoded protein is regulated by polo-like kinase 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.3 kDa |
AA Sequence : | MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPR TPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKR SMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQV WGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQ GSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLS LFEDTLDPTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Full Length : | Full L. |
Gene Name | PKMYT1 protein kinase, membrane associated tyrosine/threonine 1 [ Homo sapiens (human) ] |
Official Symbol | PKMYT1 |
Synonyms | MYT1; PPP1R126 |
Gene ID | 9088 |
mRNA Refseq | NM_004203.5 |
Protein Refseq | NP_004194.3 |
MIM | 602474 |
UniProt ID | Q99640 |
◆ Recombinant Proteins | ||
PKMYT1-0057H | Recombinant Human PKMYT1 Protein (L2-T499), Tag Free | +Inquiry |
PKMYT1-7007H | Recombinant Human MYT1, GST-tagged | +Inquiry |
PKMYT1-918HFL | Recombinant Full Length Human PKMYT1 Protein, C-Flag-tagged | +Inquiry |
PKMYT1-5959H | Recombinant Human PKMYT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PKMYT1-1695HF | Active Recombinant Full Length Human PKMYT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKMYT1-3151HCL | Recombinant Human PKMYT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PKMYT1 Products
Required fields are marked with *
My Review for All PKMYT1 Products
Required fields are marked with *
0
Inquiry Basket