Recombinant Full Length Human PLA2G10 Protein, C-Flag-tagged
Cat.No. : | PLA2G10-103HFL |
Product Overview : | Recombinant Full Length Human PLA2G10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the phospholipase A2 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This calcium-dependent enzyme hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids. In one example, this enzyme catalyzes the release of arachidonic acid from cell membrane phospholipids, thus playing a role in the production of various inflammatory lipid mediators, such as prostaglandins. The encoded protein may promote the survival of breast cancer cells through its role in lipid metabolism. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18 kDa |
AA Sequence : | MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCG LGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCL AQTEYNLKYLFYPQFLCEPDSPKCDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways : | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | PLA2G10 phospholipase A2 group X [ Homo sapiens (human) ] |
Official Symbol | PLA2G10 |
Synonyms | SPLA2; GXPLA2; GXSPLA2; sPLA2-X |
Gene ID | 8399 |
mRNA Refseq | NM_003561.3 |
Protein Refseq | NP_003552.1 |
MIM | 603603 |
UniProt ID | O15496 |
◆ Recombinant Proteins | ||
PLA2G10-09H | Recombinant Human PLA2G10 Protein, DYKDDDDK-tagged | +Inquiry |
PLA2G10-4484R | Recombinant Rat PLA2G10 Protein | +Inquiry |
PLA2G10-103HFL | Recombinant Full Length Human PLA2G10 Protein, C-Flag-tagged | +Inquiry |
PLA2G10-5207H | Recombinant Human PLA2G10 Protein (Glu32-Asp165), N-His tagged | +Inquiry |
PLA2G10-4144R | Recombinant Rat PLA2G10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G10-3145HCL | Recombinant Human PLA2G10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G10 Products
Required fields are marked with *
My Review for All PLA2G10 Products
Required fields are marked with *
0
Inquiry Basket