Recombinant Full Length Human PLAAT3 Protein, C-Flag-tagged
| Cat.No. : | PLAAT3-373HFL |
| Product Overview : | Recombinant Full Length Human PLAAT3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables N-acyltransferase activity; phospholipase A1 activity; and phospholipase A2 activity. Involved in N-acylphosphatidylethanolamine metabolic process. Predicted to be located in several cellular components, including lysosome; nuclear envelope; and peroxisome. Predicted to be active in cytoplasm. Biomarker of seminoma. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 17.8 kDa |
| AA Sequence : | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA GMGLAAMSLIGVMFSRNKRQKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transmembrane |
| Full Length : | Full L. |
| Gene Name | PLAAT3 phospholipase A and acyltransferase 3 [ Homo sapiens (human) ] |
| Official Symbol | PLAAT3 |
| Synonyms | AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1 |
| Gene ID | 11145 |
| mRNA Refseq | NM_007069.3 |
| Protein Refseq | NP_009000.2 |
| MIM | 613867 |
| UniProt ID | P53816 |
| ◆ Recombinant Proteins | ||
| PLAAT3-1696H | Recombinant Human PLAAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLAAT3-373HFL | Recombinant Full Length Human PLAAT3 Protein, C-Flag-tagged | +Inquiry |
| PLAAT3-4801H | Recombinant Human PLAAT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Plaat3-4905M | Recombinant Mouse Plaat3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAAT3 Products
Required fields are marked with *
My Review for All PLAAT3 Products
Required fields are marked with *
