Recombinant Full Length Human Plasminogen Receptor (Kt)(C9Orf46) Protein, His-Tagged
Cat.No. : | RFL5942HF |
Product Overview : | Recombinant Full Length Human Plasminogen receptor (KT)(C9orf46) Protein (Q9HBL7) (1-147aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-147) |
Form : | Lyophilized powder |
AA Sequence : | MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTF FGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSK LQLPRGMITFESIEKARKEQSRFFIDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PLGRKT |
Synonyms | PLGRKT; C9orf46; AD025; MDS030; Plasminogen receptor; KT; Plg-R(KT |
UniProt ID | Q9HBL7 |
◆ Recombinant Proteins | ||
PLGRKT-4183R | Recombinant Rat PLGRKT Protein, His (Fc)-Avi-tagged | +Inquiry |
PLGRKT-3384Z | Recombinant Zebrafish PLGRKT | +Inquiry |
RFL5942HF | Recombinant Full Length Human Plasminogen Receptor (Kt)(C9Orf46) Protein, His-Tagged | +Inquiry |
RFL14810MF | Recombinant Full Length Mouse Plasminogen Receptor (Kt) Protein, His-Tagged | +Inquiry |
PLGRKT-3473R | Recombinant Rhesus monkey PLGRKT Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPAB8782 | Rabbit Anti-PLGRKT Polyclonal Antibody | +Inquiry |
PLGRKT-7928HCL | Recombinant Human C9orf46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLGRKT Products
Required fields are marked with *
My Review for All PLGRKT Products
Required fields are marked with *