Recombinant Full Length Human POU3F2 Protein, C-Flag-tagged
Cat.No. : | POU3F2-2189HFL |
Product Overview : | Recombinant Full Length Human POU3F2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.7 kDa |
AA Sequence : | MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGG GGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQ QQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGL HHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQR RIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAA QGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP GAEDVYGGSRDTPPHHGVQTPVQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | POU3F2 POU class 3 homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | POU3F2 |
Synonyms | BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3 |
Gene ID | 5454 |
mRNA Refseq | NM_005604.4 |
Protein Refseq | NP_005595.2 |
MIM | 600494 |
UniProt ID | P20265 |
◆ Recombinant Proteins | ||
POU3F2-6953M | Recombinant Mouse POU3F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
POU3F2-132H | Recombinant Human POU3F2 protein, Arginine-tagged | +Inquiry |
Pou3f2-5020M | Recombinant Mouse Pou3f2 Protein, Myc/DDK-tagged | +Inquiry |
POU3F2-1865H | Recombinant Human POU3F2, GST-tagged | +Inquiry |
POU3F2-4244R | Recombinant Rat POU3F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POU3F2 Products
Required fields are marked with *
My Review for All POU3F2 Products
Required fields are marked with *
0
Inquiry Basket