Recombinant Full Length Human POU5F1 protein, His-B2M-tagged

Cat.No. : POU5F1-3359H
Product Overview : Recombinant Human POU5F1 protein(Q01860)(1-360aa), fused to N-terminal His-B2M tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 1-360aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 52.6 kDa
AA Sequence : MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name POU5F1 POU class 5 homeobox 1 [ Homo sapiens ]
Official Symbol POU5F1
Synonyms POU5F1; POU class 5 homeobox 1; OTF3, POU domain class 5, transcription factor 1; POU domain, class 5, transcription factor 1; MGC22487; OCT3; Oct4; octamer-binding protein 3; octamer-binding protein 4; POU domain transcription factor OCT4; octamer-binding transcription factor 3; octamer-binding transcription factor-3; POU-type homeodomain-containing DNA-binding protein; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4;
Gene ID 5460
mRNA Refseq NM_001173531
Protein Refseq NP_001167002
MIM 164177
UniProt ID Q01860

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POU5F1 Products

Required fields are marked with *

My Review for All POU5F1 Products

Required fields are marked with *

0
cart-icon