Recombinant Full Length Human POU5F1 protein, His-B2M-tagged
| Cat.No. : | POU5F1-3359H |
| Product Overview : | Recombinant Human POU5F1 protein(Q01860)(1-360aa), fused to N-terminal His-B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 1-360aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.6 kDa |
| AA Sequence : | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | POU5F1 POU class 5 homeobox 1 [ Homo sapiens ] |
| Official Symbol | POU5F1 |
| Synonyms | POU5F1; POU class 5 homeobox 1; OTF3, POU domain class 5, transcription factor 1; POU domain, class 5, transcription factor 1; MGC22487; OCT3; Oct4; octamer-binding protein 3; octamer-binding protein 4; POU domain transcription factor OCT4; octamer-binding transcription factor 3; octamer-binding transcription factor-3; POU-type homeodomain-containing DNA-binding protein; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4; |
| Gene ID | 5460 |
| mRNA Refseq | NM_001173531 |
| Protein Refseq | NP_001167002 |
| MIM | 164177 |
| UniProt ID | Q01860 |
| ◆ Recombinant Proteins | ||
| POU5F1-113H | Recombinant Human POU5F1 Protein, 11R-tagged | +Inquiry |
| POU5F1-3631H | Recombinant Full Length Human POU Class 5 Homeobox 1/POU5F1 Protein | +Inquiry |
| Pou5f1-200M | Recombinant Mouse Pou5f1, TAT-tagged | +Inquiry |
| Pou5f1-164M | Recombinant Mouse Pou5f1, Arg-tagged | +Inquiry |
| Pou5f1-5024M | Recombinant Full Length Mouse Pou5f1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POU5F1-2999HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
| POU5F1-3000HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU5F1 Products
Required fields are marked with *
My Review for All POU5F1 Products
Required fields are marked with *
