Recombinant Full Length Human PPBP, GST-tagged
| Cat.No. : | PPBP-206H |
| Product Overview : | Recombinant Human PPBP(1 a.a. - 128 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-128 a.a. |
| Description : | This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II. |
| Molecular Mass : | 40.3 kDa |
| AA Sequence : | MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPK NIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens (human) ] |
| Official Symbol | PPBP |
| Synonyms | PPBP; PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); platelet basic protein; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7 |
| Gene ID | 5473 |
| mRNA Refseq | NM_002704 |
| Protein Refseq | NP_002695 |
| MIM | 121010 |
| UniProt ID | P02775 |
| Chromosome Location | 4q12-q13 |
| Pathway | Chemokine receptors bind chemokines; Chemokine signaling pathway; Cytokine-cytokine receptor interaction |
| Function | chemokine activity; glucose transmembrane transporter activity; growth factor activity |
| ◆ Recombinant Proteins | ||
| Ppbp-521R | Recombinant Rat Ppbp Protein, His-tagged | +Inquiry |
| PPBP-04H PPBP | Recombinant Human PPBP protein | +Inquiry |
| PPBP-3363H | Recombinant Human PPBP protein, GST-tagged | +Inquiry |
| Ppbp-630R | Recombinant Rat Ppbp protein | +Inquiry |
| PPBP-04H | Recombinant Human chemokine (C-X-C Motif) Ligand 7 | +Inquiry |
| ◆ Native Proteins | ||
| PPBP-30279TH | Native Human PPBP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
| PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *
