Recombinant Full Length Human PPBP, GST-tagged
Cat.No. : | PPBP-206H |
Product Overview : | Recombinant Human PPBP(1 a.a. - 128 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-128 a.a. |
Description : | This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II. |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPK NIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens (human) ] |
Official Symbol | PPBP |
Synonyms | PPBP; PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); platelet basic protein; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7 |
Gene ID | 5473 |
mRNA Refseq | NM_002704 |
Protein Refseq | NP_002695 |
MIM | 121010 |
UniProt ID | P02775 |
Chromosome Location | 4q12-q13 |
Pathway | Chemokine receptors bind chemokines; Chemokine signaling pathway; Cytokine-cytokine receptor interaction |
Function | chemokine activity; glucose transmembrane transporter activity; growth factor activity |
◆ Recombinant Proteins | ||
Ppbp-2162M | Recombinant Mouse Ppbp protein, His-tagged | +Inquiry |
PPBP-1073R | Recombinant Rat PPBP Protein, Fc-tagged | +Inquiry |
Ppbp-448R | Active Recombinant Rat Pro-Platelet Basic Protein (chemokine (C-X-C motif) ligand 7) | +Inquiry |
Ppbp-521R | Recombinant Rat Ppbp Protein, His-tagged | +Inquiry |
PPBP-068P | Active Recombinant Human PPBP Protein (70 aa) | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *