Recombinant Full Length Human PPP1CC protein, GST-tagged

• Cat.No.: PPP1CC-248H
• Product Overview: Recombinant Human PPP1CC protein(NP_001231903)(1-323 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-323 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ]
• Official Symbol: PPP1CC
• Synonyms: PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; serine/threonine phosphatase 1 gamma; protein phosphatase 1C catalytic subunit; PP-1G; PPP1G
• Gene ID: 5501
• mRNA Refseq: NM_001244974
• Protein Refseq: NP_001231903
• MIM: 176914
• UniProt ID: P36873