Recombinant Full Length Human PPP1CC protein, GST-tagged
| Cat.No. : | PPP1CC-248H |
| Product Overview : | Recombinant Human PPP1CC protein(NP_001231903)(1-323 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-323 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ] |
| Official Symbol | PPP1CC |
| Synonyms | PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; serine/threonine phosphatase 1 gamma; protein phosphatase 1C catalytic subunit; PP-1G; PPP1G; |
| Gene ID | 5501 |
| mRNA Refseq | NM_001244974 |
| Protein Refseq | NP_001231903 |
| MIM | 176914 |
| UniProt ID | P36873 |
| ◆ Recombinant Proteins | ||
| PPP1CC-3004H | Recombinant Human PPP1CC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PPP1CC-3559R | Recombinant Rhesus monkey PPP1CC Protein, His-tagged | +Inquiry |
| PPP1CC-844H | Active Recombinant Human PPP1CC, His-tagged | +Inquiry |
| PPP1CC-248H | Recombinant Full Length Human PPP1CC protein, GST-tagged | +Inquiry |
| PPP1CC-3367H | Recombinant Human PPP1CC protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1CC-2948HCL | Recombinant Human PPP1CC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1CC Products
Required fields are marked with *
My Review for All PPP1CC Products
Required fields are marked with *
