Recombinant Full Length Human PPP2CA Protein, C-Flag-tagged
Cat.No. : | PPP2CA-577HFL |
Product Overview : | Recombinant Full Length Human PPP2CA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase, Transcription Factors |
Protein Pathways : | Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | PPP2CA protein phosphatase 2 catalytic subunit alpha [ Homo sapiens (human) ] |
Official Symbol | PPP2CA |
Synonyms | RP-C; PP2Ac; PP2CA; NEDLBA; PP2Calpha |
Gene ID | 5515 |
mRNA Refseq | NM_002715.4 |
Protein Refseq | NP_002706.1 |
MIM | 176915 |
UniProt ID | P67775 |
◆ Recombinant Proteins | ||
PPP2CA-077H | Recombinant Human PPP2CA Protein, octahistidine/streptactin-tagged | +Inquiry |
PPP2CA-27617TH | Recombinant Human PPP2CA protein, GST-tagged | +Inquiry |
PPP2CA-409HF | Recombinant Full Length Human PPP2CA Protein, GST-tagged | +Inquiry |
PPP2CA-50H | Recombinant Human PPP2CA Protein, Full Length, N-GST tagged | +Inquiry |
PPP2CA-7029M | Recombinant Mouse PPP2CA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CA-2929HCL | Recombinant Human PPP2CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2CA Products
Required fields are marked with *
My Review for All PPP2CA Products
Required fields are marked with *
0
Inquiry Basket