Recombinant Full Length Human PRDX6 Protein, C-Flag-tagged
Cat.No. : | PRDX6-647HFL |
Product Overview : | Recombinant Full Length Human PRDX6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE LPSGKKYLRYTPQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Methane metabolism, Phenylalanine metabolism |
Full Length : | Full L. |
Gene Name | PRDX6 peroxiredoxin 6 [ Homo sapiens (human) ] |
Official Symbol | PRDX6 |
Synonyms | PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; LPCAT-5; HEL-S-128m |
Gene ID | 9588 |
mRNA Refseq | NM_004905.3 |
Protein Refseq | NP_004896.1 |
MIM | 602316 |
UniProt ID | P30041 |
◆ Recombinant Proteins | ||
PRDX6-647HFL | Recombinant Full Length Human PRDX6 Protein, C-Flag-tagged | +Inquiry |
Prdx6-32M | Recombinant Mouse Prdx6 protein, His/T7-tagged | +Inquiry |
PRDX6-3593R | Recombinant Rhesus monkey PRDX6 Protein, His-tagged | +Inquiry |
PRDX6-188H | Recombinant Human Peroxiredoxin 6, His-tagged | +Inquiry |
PRDX6-2877H | Recombinant Human Full length PRDX6 protein(1-224 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX6-2877HCL | Recombinant Human PRDX6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX6 Products
Required fields are marked with *
My Review for All PRDX6 Products
Required fields are marked with *
0
Inquiry Basket