Recombinant Full Length Human PRDX6 Protein, C-Flag-tagged

Cat.No. : PRDX6-647HFL
Product Overview : Recombinant Full Length Human PRDX6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 24.9 kDa
AA Sequence : MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE
LPSGKKYLRYTPQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Metabolic pathways, Methane metabolism, Phenylalanine metabolism
Full Length : Full L.
Gene Name PRDX6 peroxiredoxin 6 [ Homo sapiens (human) ]
Official Symbol PRDX6
Synonyms PRX; p29; AOP2; 1-Cys; NSGPx; aiPLA2; LPCAT-5; HEL-S-128m
Gene ID 9588
mRNA Refseq NM_004905.3
Protein Refseq NP_004896.1
MIM 602316
UniProt ID P30041

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX6 Products

Required fields are marked with *

My Review for All PRDX6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon