Recombinant Full Length Human Probable G-Protein Coupled Receptor 75(Gpr75) Protein, His-Tagged
Cat.No. : | RFL13027HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 75(GPR75) Protein (O95800) (1-540aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-540) |
Form : | Lyophilized powder |
AA Sequence : | MNSTGHLQDAPNATSLHVPHSQEGNSTSLQEGLQDLIHTATLVTCTFLLAVIFCLGSYGN FIVFLSFFDPAFRKFRTNFDFMILNLSFCDLFICGVTAPMFTFVLFFSSASSIPDAFCFT FHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTVLLTLLLWATSFTLATLAT LKTSKSHLCLPMSSLIAGKGKAILSLYVVDFTFCVAVVSVSYIMIAQTLRKNAQVRKCPP VITVDASRPQPFMGVPVQGGGDPIQCAMPALYRNQNYNKLQHVQTRGYTKSPNQLVTPAA SRLQLVSAINLSTAKDSKAVVTCVIIVLSVLVCCLPLGISLVQVVLSSNGSFILYQFELF GFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRN KSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIE PYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR75 |
Synonyms | G protein coupled receptor 75; GPR chr2; Gpr75; GPR75_HUMAN; GPRchr2; OTTHUMP00000159608; Probable G protein coupled receptor 75; Probable G-protein coupled receptor 75; WI 31133; WI31133 |
UniProt ID | O95800 |
◆ Recombinant Proteins | ||
GPR75-1957R | Recombinant Rhesus monkey GPR75 Protein, His-tagged | +Inquiry |
GPR75-5262H | Recombinant Human GPR75 Protein | +Inquiry |
RFL2084MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 75(Gpr75) Protein, His-Tagged | +Inquiry |
GPR75-3957H | Active Recombinant Human GPR75 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
GPR75-121H | Recombinant Human GPR75 protein(GPR75), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR75-5779HCL | Recombinant Human GPR75 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR75 Products
Required fields are marked with *
My Review for All GPR75 Products
Required fields are marked with *
0
Inquiry Basket