Recombinant Human GPR75 protein(GPR75), His-SUMO-tagged

Cat.No. : GPR75-121H
Product Overview : Recombinant Human GPR75 protein(GPR75)(NP_006785.1)(372-540aa), fused to His-SUMO-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : Cytoplasmic Domain
Description : GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.9kDa
AA Sequence : NPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name GPR75 G protein-coupled receptor 75 [ Homo sapiens (human) ]
Official Symbol GPR75
Synonyms G protein coupled receptor 75; GPR chr2; Gpr75; GPR75_HUMAN; GPRchr2; OTTHUMP00000159608; Probable G protein coupled receptor 75; Probable G-protein coupled receptor 75; WI 31133; WI31133
Gene ID 10936
mRNA Refseq NM_006794.4
Protein Refseq NP_006785.1
MIM 606704
UniProt ID O95800

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR75 Products

Required fields are marked with *

My Review for All GPR75 Products

Required fields are marked with *

0
cart-icon
0
compare icon