Recombinant Full Length Human Probable N-Acetyltransferase 8B(Nat8B) Protein, His-Tagged
Cat.No. : | RFL27433HF |
Product Overview : | Recombinant Full Length Human Probable N-acetyltransferase 8B(NAT8B) Protein (Q9UHF3) (1-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-227) |
Form : | Lyophilized powder |
AA Sequence : | MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSW ILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVG TVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNI QLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NAT8B |
Synonyms | NAT8B; CML2; Putative N-acetyltransferase 8B; Acetyltransferase 1; ATase1; Camello-like protein 2 |
UniProt ID | Q9UHF3 |
◆ Recombinant Proteins | ||
RFL27433HF | Recombinant Full Length Human Probable N-Acetyltransferase 8B(Nat8B) Protein, His-Tagged | +Inquiry |
NAT8B-1540H | Recombinant Human NAT8B Protein, GST-tagged | +Inquiry |
NAT8B-3909R | Recombinant Rat NAT8B Protein | +Inquiry |
NAT8B-3568R | Recombinant Rat NAT8B Protein, His (Fc)-Avi-tagged | +Inquiry |
NAT8B-3302H | Recombinant Human NAT8B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT8B-3961HCL | Recombinant Human NAT8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT8B Products
Required fields are marked with *
My Review for All NAT8B Products
Required fields are marked with *