Recombinant Human NAT8B Protein, GST-tagged

Cat.No. : NAT8B-1540H
Product Overview : Human CML2 partial ORF ( NP_057431.1, 83 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.41 kDa
AA Sequence : TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NAT8B N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) [ Homo sapiens ]
Official Symbol NAT8B
Synonyms NAT8B; N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene); N acetyltransferase 8B (gene/pseudogene); probable N-acetyltransferase 8B; Hcml2; NAT8BP; camello-like protein 2; N-acetyltransferase Camello 2; N-acetyltransferase 8B (gene/pseudogene); CML2; MGC97061;
Gene ID 51471
mRNA Refseq NM_016347
Protein Refseq NP_057431
MIM 608190
UniProt ID Q9UHF3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAT8B Products

Required fields are marked with *

My Review for All NAT8B Products

Required fields are marked with *

0
cart-icon