Recombinant Human NAT8B Protein, GST-tagged
Cat.No. : | NAT8B-1540H |
Product Overview : | Human CML2 partial ORF ( NP_057431.1, 83 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.41 kDa |
AA Sequence : | TRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NAT8B N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene) [ Homo sapiens ] |
Official Symbol | NAT8B |
Synonyms | NAT8B; N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene); N acetyltransferase 8B (gene/pseudogene); probable N-acetyltransferase 8B; Hcml2; NAT8BP; camello-like protein 2; N-acetyltransferase Camello 2; N-acetyltransferase 8B (gene/pseudogene); CML2; MGC97061; |
Gene ID | 51471 |
mRNA Refseq | NM_016347 |
Protein Refseq | NP_057431 |
MIM | 608190 |
UniProt ID | Q9UHF3 |
◆ Recombinant Proteins | ||
NAT8B-4660C | Recombinant Chicken NAT8B | +Inquiry |
RFL27433HF | Recombinant Full Length Human Probable N-Acetyltransferase 8B(Nat8B) Protein, His-Tagged | +Inquiry |
NAT8B-1540H | Recombinant Human NAT8B Protein, GST-tagged | +Inquiry |
NAT8B-3909R | Recombinant Rat NAT8B Protein | +Inquiry |
NAT8B-3302H | Recombinant Human NAT8B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT8B-3961HCL | Recombinant Human NAT8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT8B Products
Required fields are marked with *
My Review for All NAT8B Products
Required fields are marked with *