Recombinant Full Length Human Probable Palmitoyltransferase Zdhhc20(Zdhhc20) Protein, His-Tagged
Cat.No. : | RFL16505HF |
Product Overview : | Recombinant Full Length Human Probable palmitoyltransferase ZDHHC20(ZDHHC20) Protein (Q5W0Z9) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHL FFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTS ASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLL YCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRT TIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMD PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVT VAIEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZDHHC20 |
Synonyms | ZDHHC20; Palmitoyltransferase ZDHHC20; Acyltransferase ZDHHC20; DHHC domain-containing cysteine-rich protein 20; DHHC20; Zinc finger DHHC domain-containing protein 20 |
UniProt ID | Q5W0Z9 |
◆ Recombinant Proteins | ||
RFL16505HF | Recombinant Full Length Human Probable Palmitoyltransferase Zdhhc20(Zdhhc20) Protein, His-Tagged | +Inquiry |
RFL19495MF | Recombinant Full Length Mouse Probable Palmitoyltransferase Zdhhc20(Zdhhc20) Protein, His-Tagged | +Inquiry |
ZDHHC20-10316M | Recombinant Mouse ZDHHC20 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZDHHC20-3459H | Recombinant Human ZDHHC20 protein, His-tagged | +Inquiry |
ZDHHC20-18787M | Recombinant Mouse ZDHHC20 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC20-747HCL | Recombinant Human ZDHHC20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC20 Products
Required fields are marked with *
My Review for All ZDHHC20 Products
Required fields are marked with *
0
Inquiry Basket