Recombinant Human ZDHHC20 protein, His-tagged
Cat.No. : | ZDHHC20-3459H |
Product Overview : | Recombinant Human ZDHHC20 protein(79-153 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 79-153 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZDHHC20 zinc finger, DHHC-type containing 20 [ Homo sapiens ] |
Official Symbol | ZDHHC20 |
Synonyms | ZDHHC20; zinc finger, DHHC-type containing 20; probable palmitoyltransferase ZDHHC20; FLJ25952; DHHC-20; 4933421L13Rik; DHHC-containing protein 20; zinc finger, DHHC domain containing 20; zinc finger DHHC domain-containing protein 20; MGC126005; |
Gene ID | 253832 |
mRNA Refseq | NM_153251 |
Protein Refseq | NP_694983 |
UniProt ID | Q5W0Z9 |
◆ Cell & Tissue Lysates | ||
ZDHHC20-747HCL | Recombinant Human ZDHHC20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZDHHC20 Products
Required fields are marked with *
My Review for All ZDHHC20 Products
Required fields are marked with *
0
Inquiry Basket