Recombinant Full Length Human Protein Fam118A(Fam118A) Protein, His-Tagged
Cat.No. : | RFL30952HF |
Product Overview : | Recombinant Full Length Human Protein FAM118A(FAM118A) Protein (Q9NWS6) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVI EAAEQLEVLHPGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDD LEQHIRSPVVLQSILSLMDRGAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWAR GHMKYGVLHIHGLYTDPCGVVLDPSGYKDVTQDAEVMEVLQNLYRTKSFLFVGCGETLRD QIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQ DLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSDTDDAGGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAM118A |
Synonyms | FAM118A; C22orf8; Protein FAM118A |
UniProt ID | Q9NWS6 |
◆ Recombinant Proteins | ||
FAM118A-453H | Recombinant Human FAM118A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL3640MF | Recombinant Full Length Mouse Protein Fam118A(Fam118A) Protein, His-Tagged | +Inquiry |
FAM118A-2968M | Recombinant Mouse FAM118A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM118A-5471M | Recombinant Mouse FAM118A Protein | +Inquiry |
Fam118a-1415M | Recombinant Mouse Fam118a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM118A-6446HCL | Recombinant Human FAM118A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM118A Products
Required fields are marked with *
My Review for All FAM118A Products
Required fields are marked with *
0
Inquiry Basket