Recombinant Human FAM118A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM118A-453H
Product Overview : FAM118A MS Standard C13 and N15-labeled recombinant protein (NP_060381) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM118A (Family With Sequence Similarity 118 Member A) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is FAM118B.
Molecular Mass : 40.3 kDa
AA Sequence : MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVIEAAEQLEVLHPGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDDLEQHIRSPLVLQSILSLMDRGAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWARGHMKYGVLHIHGLYRDPCGVVLDPSGYKDVTQDAEVMEVLQNLYRTKSFLFVGCGETLHDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSDTDDAGGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM118A family with sequence similarity 118 member A [ Homo sapiens (human) ]
Official Symbol FAM118A
Synonyms FAM118A; family with sequence similarity 118, member A; C22orf8, chromosome 22 open reading frame 8; protein FAM118A; bK268H5.C22.4; FLJ20635; C22orf8;
Gene ID 55007
mRNA Refseq NM_017911
Protein Refseq NP_060381
UniProt ID Q9NWS6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM118A Products

Required fields are marked with *

My Review for All FAM118A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon