Recombinant Full Length Human Protein Shisa-3 Homolog(Shisa3) Protein, His-Tagged
Cat.No. : | RFL13854HF |
Product Overview : | Recombinant Full Length Human Protein shisa-3 homolog(SHISA3) Protein (A0PJX4) (22-238aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-238) |
Form : | Lyophilized powder |
AA Sequence : | QQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSCALRYCCAAADARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYCCTCLRPKEPSQQPIRFSLRSYQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGFLVSPQYFAYPLQQEPPLPGKSCPDFSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHISA3 |
Synonyms | SHISA3; Protein shisa-3 homolog |
UniProt ID | A0PJX4 |
◆ Recombinant Proteins | ||
SHISA3-1853H | Recombinant Human SHISA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Shisa3-5864M | Recombinant Mouse Shisa3 Protein, Myc/DDK-tagged | +Inquiry |
SHISA3-15102M | Recombinant Mouse SHISA3 Protein | +Inquiry |
RFL13854HF | Recombinant Full Length Human Protein Shisa-3 Homolog(Shisa3) Protein, His-Tagged | +Inquiry |
SHISA3-5140Z | Recombinant Zebrafish SHISA3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHISA3-1857HCL | Recombinant Human SHISA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHISA3 Products
Required fields are marked with *
My Review for All SHISA3 Products
Required fields are marked with *