Recombinant Full Length Human PRSS30P Protein, GST-tagged

Cat.No. : PRSS30P-6433HF
Product Overview : Human MGC52282 full-length ORF ( Q8IVY7, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 146 amino acids
Description : PRSS30P (Protease, Serine, 30 Pseudogene) is a Pseudogene.
Molecular Mass : 41.9 kDa
AA Sequence : MRPLQGGREDCGRPRHPGRTLAVAGWPVVDLSGACMWGLPHPPTLGAHSRPLLPEGDSGGPLVCPINDTWIQAGIVSWGFGCARPFRPGVYTQVLSYTDWIQRTLAESHSGMSGARPGAPGSHSGTSRSHPVLLLELLTVCLLGSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PRSS30P protease, serine, 30 pseudogene [ Homo sapiens (human) ]
Official Symbol PRSS30P
Synonyms PRSS30P; protease, serine, 30 pseudogene; protease, serine, 30 homolog, pseudogene; transmembrane protease, serine 8 homolog, pseudogene; transmembrane protease, serine pseudogene
Gene ID 124221

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS30P Products

Required fields are marked with *

My Review for All PRSS30P Products

Required fields are marked with *

0
cart-icon